Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

LY6G6D Protein, Mouse, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04291 Copy Product Info
LY6G6D Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is Q9Z1Q3.

LY6G6D Protein, Mouse, Recombinant (His)

Catalog No. TMPH-04291
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

LY6G6D Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is Q9Z1Q3.

LY6G6D Protein, Mouse, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$9820 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$39720 days20 days
100 μg$53620 days20 days
200 μg$82920 days20 days
500 μg$1,48020 days20 days
1 mg$2,30020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA2HU). The EC50 is 1.159-2.305 μg/mL.
Description
LY6G6D Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is Q9Z1Q3.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ9Z1Q3
Synonyms
Ng25,Lymphocyte antigen 6 complex locus protein G6d,Ly6g6d
Amino Acid
HRTRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
Construction
20-108 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight11.1 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords