LY6G6D Protein, Mouse, Recombinant (His)

Name: LY6G6D Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04291
Rating: 4.5 (1 reviews)

(Synonyms: Ng25, Lymphocyte antigen 6 complex locus protein G6d, Ly6g6d) Copy Product Info

Synonyms: Ng25, Lymphocyte antigen 6 complex locus protein G6d, Ly6g6d

Catalog No. TMPH-04291 Copy Product Info

LY6G6D Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is Q9Z1Q3.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$98	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	20 days	20 days
50 µg	$397	20 days	20 days
100 µg	$536	20 days	20 days
200 µg	$829	20 days	20 days
500 µg	$1,480	20 days	20 days
1 mg	$2,300	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA2HU). The EC50 is 1.159-2.305 μg/mL.
Description	LY6G6D Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is Q9Z1Q3.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q9Z1Q3
Amino Acid	HRTRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
Construction	20-108 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Ng25, Lymphocyte antigen 6 complex locus protein G6d, Ly6g6d

Chemical Properties

Molecular Weight

11.1 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.