Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

LY6G6D Protein, Mouse, Recombinant (His)

Catalog No. TMPH-04291

LY6G6D Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is Q9Z1Q3.

LY6G6D Protein, Mouse, Recombinant (His)

LY6G6D Protein, Mouse, Recombinant (His)

Catalog No. TMPH-04291
LY6G6D Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is Q9Z1Q3.
Pack SizePriceAvailabilityQuantity
20 μg$28320 days
100 μg$53620 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA2HU). The EC50 is 1.159-2.305 μg/mL.
Description
LY6G6D Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is Q9Z1Q3.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ9Z1Q3
Synonyms
Ng25,Lymphocyte antigen 6 complex locus protein G6d,Ly6g6d
Amino Acid
HRTRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
Construction
20-108 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight11.1 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords