LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is UJY53414.1.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 295.00 | |
100 μg | 20 days | $ 481.00 |
Description | LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is UJY53414.1. |
Species | Cynomolgus |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis |
Accession Number | UJY53414.1 |
Amino Acid | NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS |
Construction | 20-104 aa |
Protein Purity | > 95% as determined by SDS-PAGE. |
Molecular Weight | 11.1 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
recombinant recombinant-proteins proteins protein