Home Tools
Log in
Cart

LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His)

Catalog No. TMPH-02433

LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is UJY53414.1.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 295.00
100 μg 20 days $ 481.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is UJY53414.1.
Species Cynomolgus
Expression System P. pastoris (Yeast)
Tag N-6xHis
Accession Number UJY53414.1
Amino Acid NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS
Construction 20-104 aa
Protein Purity > 95% as determined by SDS-PAGE.
Molecular Weight 11.1 kDa (predicted)
Endotoxin < 1.0 EU/μg of the protein as determined by the LAL method.
Formulation Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol