Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 3.963-7.154 ng/mL.

LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is UJY53414.1.

Cynomolgus

P. pastoris (Yeast)

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS

20-104 aa

> 95% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.