Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His)

Catalog No. TMPH-02433

LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is UJY53414.1.

LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His)

LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His)

Catalog No. TMPH-02433
LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is UJY53414.1.
Pack SizePriceAvailabilityQuantity
20 μg$25620 days
100 μg$52820 days
1 mg$2,36020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 3.963-7.154 ng/mL.
Description
LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is UJY53414.1.
Species
Cynomolgus
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberUJY53414.1
Amino Acid
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS
Construction
20-104 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight11.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.