Shopping Cart
Remove All
Your shopping cart is currently empty
LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is UJY53414.1.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $95 | 20 days | 20 days | |
| 10 μg | $155 | 20 days | 20 days | |
| 20 μg | $256 | 20 days | 20 days | |
| 50 μg | $386 | 20 days | 20 days | |
| 100 μg | $528 | 20 days | 20 days | |
| 200 μg | $827 | 20 days | 20 days | |
| 500 μg | $1,480 | 20 days | 20 days | |
| 1 mg | $2,360 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 3.963-7.154 ng/mL. |
| Description | LY6G6D Protein, Cynomolgus, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is UJY53414.1. |
| Species | Cynomolgus |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | UJY53414.1 |
| Amino Acid | NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS |
| Construction | 20-104 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Molecular Weight | 11.1 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.