Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

LY6C1 Protein, Mouse, Recombinant (His & SUMOstar)

Catalog No. TMPH-02765

LY6C1 Protein, Mouse, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 25.1 kDa and the accession number is P0CW02.

LY6C1 Protein, Mouse, Recombinant (His & SUMOstar)

LY6C1 Protein, Mouse, Recombinant (His & SUMOstar)

Catalog No. TMPH-02765
LY6C1 Protein, Mouse, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 25.1 kDa and the accession number is P0CW02.
Pack SizePriceAvailabilityQuantity
20 μg$39720 days
100 μg$84520 days
500 μg$1,95020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
LY6C1 Protein, Mouse, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 25.1 kDa and the accession number is P0CW02.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagN-6xHis-SUMOstar
Accession NumberP0CW02
Synonyms
Lymphocyte antigen 6C1,Ly-6C1,Ly6c1
Amino Acid
LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Construction
27-109 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight25.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords