Shopping Cart
- Remove All
- Your shopping cart is currently empty
Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. Lutropin subunit beta Protein, Bovine, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17.0 kDa and the accession number is P04651.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $129 | 20 days | |
10 μg | $216 | 20 days | |
20 μg | $360 | 20 days | |
50 μg | $543 | 20 days | |
100 μg | $745 | 20 days | |
200 μg | $1,070 | 20 days | |
500 μg | $1,730 | 20 days | |
1 mg | $2,530 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. Lutropin subunit beta Protein, Bovine, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17.0 kDa and the accession number is P04651. |
Species | Bovine |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | P04651 |
Synonyms | Lutropin subunit beta,Lutropin beta chain,Luteinizing hormone subunit beta (LH-B;LSH-B;LSH-beta),LHB |
Amino Acid | SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL |
Construction | 21-141 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 17.0 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.