Shopping Cart
Remove All
Your shopping cart is currently empty
LOX Protein, Human, Recombinant (His & MBP)
Catalog No. TMPH-01968 Copy Product Info
LOX Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus.
LOX Protein, Human, Recombinant (His & MBP)
Catalog No. TMPH-01968
Copy Product InfoLOX Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $119 | 20 days | 20 days | |
| 10 μg | $196 | 20 days | 20 days | |
| 20 μg | $326 | 20 days | 20 days | |
| 50 μg | $597 | 20 days | 20 days | |
| 100 μg | $987 | 20 days | 20 days | |
| 200 μg | $1,280 | 20 days | 20 days | |
| 500 μg | $1,870 | 20 days | 20 days | |
| 1 mg | $2,480 | 20 days | 20 days |
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | LOX Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus. |
| Species | Human |
| Expression System | Baculovirus Insect Cells |
| Tag | N-MBP, C-6xHis |
| Accession Number | P28300 |
| Synonyms | Protein-lysine 6-oxidase,Lysyl oxidase,LOX |
| Amino Acid | DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY |
| Construction | 169-417 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 73.0 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.