Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

LOX Protein, Human, Recombinant (His & MBP)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01968

LOX Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus.

LOX Protein, Human, Recombinant (His & MBP)

LOX Protein, Human, Recombinant (His & MBP)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01968
LOX Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$11920 days20 days
10 μg$19620 days20 days
20 μg$32620 days20 days
50 μg$59720 days20 days
100 μg$98720 days20 days
200 μg$1,28020 days20 days
500 μg$1,87020 days20 days
1 mg$2,48020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
LOX Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus.
Species
Human
Expression System
Baculovirus Insect Cells
TagN-MBP, C-6xHis
Accession NumberP28300
Synonyms
Protein-lysine 6-oxidase,Lysyl oxidase,LOX
Amino Acid
DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Construction
169-417 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight73.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.