LOX Protein, Mouse, Recombinant (His & Myc)

Name: LOX Protein, Mouse, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-02863
Rating: 4.5 (1 reviews)

(Synonyms: Rrg, Ras excision protein, Protein-lysine 6-oxidase, Lysyl oxidase, Lox) Copy Product Info

Synonyms: Rrg, Ras excision protein, Protein-lysine 6-oxidase, Lysyl oxidase, Lox

Catalog No. TMPH-02863 Copy Product Info

Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.

LOX Protein, Mouse, Recombinant (His & Myc)

Pack Size	Price	USA Stock	Global Stock
5 µg	$108	20 days	20 days
10 µg	$177	20 days	20 days
20 µg	$293	20 days	20 days
50 µg	$549	20 days	20 days
100 µg	$890	20 days	20 days
200 µg	$987	20 days	20 days
500 µg	$1,290	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.
Species	Mouse
Expression System	Baculovirus Insect Cells
Tag	C-6xHis-Myc
Accession Number	P28301
Amino Acid	DDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Construction	163-411 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Rrg, Ras excision protein, Protein-lysine 6-oxidase, Lysyl oxidase, Lox
Research Background	Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.

Chemical Properties

Molecular Weight

32.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.