Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

LEB6 Protein, Vicia faba, Recombinant (His)

Catalog No. TMPH-03706

This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals. LEB6 Protein, Vicia faba, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 19.0 kDa and the accession number is P16079.

LEB6 Protein, Vicia faba, Recombinant (His)

LEB6 Protein, Vicia faba, Recombinant (His)

Catalog No. TMPH-03706
This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals. LEB6 Protein, Vicia faba, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 19.0 kDa and the accession number is P16079.
Pack SizePriceAvailabilityQuantity
20 μg $39720 days
100 μg $84520 days
500 μg $1,95020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals. LEB6 Protein, Vicia faba, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 19.0 kDa and the accession number is P16079.
Species
Vicia faba
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP16079
Synonyms
Legumin type B,LEB6
Amino Acid
GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN
Construction
1-148 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight19.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords