Shopping Cart
- Remove All
 Your shopping cart is currently empty Your shopping cart is currently empty
Lake Victoria marburgvirus (MARV) (strain Popp-67) L Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.7 kDa and the accession number is P35262.

| Pack Size | Price | Availability | Quantity | 
|---|---|---|---|
| 5 μg | $129 | 20 days | |
| 10 μg | $216 | 20 days | |
| 20 μg | $360 | 20 days | |
| 50 μg | $543 | 20 days | |
| 100 μg | $745 | 20 days | |
| 200 μg | $1,070 | 20 days | |
| 500 μg | $1,730 | 20 days | |
| 1 mg | $2,530 | 20 days | 
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. | 
| Description | Lake Victoria marburgvirus (MARV) (strain Popp-67) L Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.7 kDa and the accession number is P35262. | 
| Species | MARV | 
| Expression System | E. coli | 
| Tag | N-10xHis, C-Myc | 
| Accession Number | P35262 | 
| Synonyms | Transcriptase,RNA-directed RNA polymerase L,Replicase,Protein L,Large structural protein | 
| Amino Acid | RGASFVTDLEKYNLAFRYEFTRHFIDYCNRCYGVKNLFDWMHFLIPLCYMHVSDFYSPPHCVTEDNRNNPPDCANAYHYHLGGIEGLQQKLWTCISCAQITLVELKTKLKLKSSVMGDNQCITTLSLFPIDAPDDYQENEAELNAARVAVELAITTGYDGIFLKPEETFVHSGFIYFGKKQYLNG | 
| Construction | 628-812 aa | 
| Protein Purity | > 90% as determined by SDS-PAGE. | 
| Molecular Weight | 28.7 kDa (predicted) | 
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. | 
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. | 
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. | 
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. | 
| Research Background | RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concommitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene.; RNA-directed RNA polymerase that catalyzes the replication of viral genomic RNA. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The replicase mode is dependent on intracellular N protein concentration. In this mode, the polymerase replicates the whole viral genome without recognizing transcriptional signals, and the replicated genome is not caped or polyadenylated. | 

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.