Shopping Cart
- Remove All
- Your shopping cart is currently empty
Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $129 | 20 days | |
10 μg | $216 | 20 days | |
20 μg | $360 | 20 days | |
50 μg | $543 | 20 days | |
100 μg | $745 | 20 days | |
200 μg | $1,070 | 20 days | |
500 μg | $1,730 | 20 days | |
1 mg | $2,530 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling. |
Species | MARV |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | P35259 |
Synonyms | VP35,Polymerase cofactor VP35,Marburg VP35 (mVP35) |
Amino Acid | MWDSSYMQQVSEGLMTGKVPIDQVFGANPLEKLYKRRKPKGTVGLQCSPCLMSKATSTDDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAKYDHLVISTGRTTAPAAAFDAYLNEHGVPPPQPAIFKDLGVAQQACSKGTMVKNATTDAADKMSKVLELSEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPSQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI |
Construction | 1-329 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 40.2 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.