KIR3DL2 Protein, Human, Recombinant (His)

Name: KIR3DL2 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03990
Rating: 4.5 (1 reviews)

(Synonyms: p70 natural killer cell receptor clone CL-5 (p70 NK receptor CL-5), NKAT4, Natural killer-associated transcript 4 (NKAT-4), KIR3DL2, Killer cell immunoglobulin-like receptor 3DL2, CD158k, CD158 antigen-like family member K) Copy Product Info

Synonyms: p70 natural killer cell receptor clone CL-5 (p70 NK receptor CL-5), NKAT4, Natural killer-associated transcript 4 (NKAT-4), KIR3DL2, Killer cell immunoglobulin-like receptor 3DL2, CD158k, CD158 antigen-like family member K

Catalog No. TMPH-03990 Copy Product Info

KIR3DL2 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P43630.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$50	20 days	20 days
10 μg	$79	20 days	20 days
20 μg	$127	20 days	20 days
50 μg	$213	20 days	20 days
100 μg	$319	20 days	20 days
200 μg	$576	20 days	20 days
500 μg	$1,270	20 days	20 days
1 mg	$2,320	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human KIR3DL2 at 2 μg/mL can bind Anti-KIR3DL2 recombinant antibody (CSB-RA012365MA1HU), the EC50 is 14.18-23.93 ng/mL.
Description	KIR3DL2 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P43630.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	P43630
Amino Acid	LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH
Construction	22-340 aa
Protein Purity	>90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	p70 natural killer cell receptor clone CL-5 (p70 NK receptor CL-5), NKAT4, Natural killer-associated transcript 4 (NKAT-4), KIR3DL2, Killer cell immunoglobulin-like receptor 3DL2, CD158k, CD158 antigen-like family member K

Chemical Properties

Molecular Weight

36.4 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

p70 NK receptor CL-5p70 NK receptor CL5NKAT-4NKAT 4KIR3DL 2

Related Tags: KIR3DL2 Protein, Human, Recombinant (His) chemical structure | KIR3DL2 Protein, Human, Recombinant (His) molecular weight