Shopping Cart
Remove All
Your shopping cart is currently empty
KIR3DL2 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P43630.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $50 | 20 days | 20 days | |
| 10 μg | $79 | 20 days | 20 days | |
| 20 μg | $127 | 20 days | 20 days | |
| 50 μg | $213 | 20 days | 20 days | |
| 100 μg | $319 | 20 days | 20 days | |
| 200 μg | $576 | 20 days | 20 days | |
| 500 μg | $1,270 | 20 days | 20 days | |
| 1 mg | $2,320 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human KIR3DL2 at 2 μg/mL can bind Anti-KIR3DL2 recombinant antibody (CSB-RA012365MA1HU), the EC50 is 14.18-23.93 ng/mL. |
| Description | KIR3DL2 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P43630. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-10xHis |
| Accession Number | P43630 |
| Synonyms | p70 natural killer cell receptor clone CL-5 (p70 NK receptor CL-5),NKAT4,Natural killer-associated transcript 4 (NKAT-4),KIR3DL2,Killer cell immunoglobulin-like receptor 3DL2,CD158k,CD158 antigen-like family member K |
| Amino Acid | LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH |
| Construction | 22-340 aa |
| Protein Purity | >90% as determined by SDS-PAGE. |
| Molecular Weight | 36.4 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.