KCP Protein, Mouse, Recombinant (His & Myc)

Name: KCP Protein, Mouse, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-02748
Rating: 4.5 (1 reviews)

(Synonyms: Kielin/chordin-like protein 1 (KCP-1), Kielin/chordin-like protein, Kcp1, Kcp, Cysteine-rich motor neuron 2 protein (CRIM-2), Cysteine-rich BMP regulator 2, Crim2) Copy Product Info

Synonyms: Kielin/chordin-like protein 1 (KCP-1), Kielin/chordin-like protein, Kcp1, Kcp, Cysteine-rich motor neuron 2 protein (CRIM-2), Cysteine-rich BMP regulator 2, Crim2

Catalog No. TMPH-02748 Copy Product Info

Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways. KCP Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 44.7 kDa and the accession number is Q3U492.

KCP Protein, Mouse, Recombinant (His & Myc)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways. KCP Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 44.7 kDa and the accession number is Q3U492.
Species	Mouse
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	Q3U492
Amino Acid	QALSNCTEDLVGSELVPPDPCYTCQCQDLTWLCTHRACPELSCPLWERHTTPGSCCPVCKDPTQSCMHQGRWVASGEQWAVDACTSCSCVAGTVHCQTQRCRKLACSRDEVPALSPGSCCLRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHGEDFSVHVTNDDRGRRGVAWTQEVAVLLGTVAVRLLQGRTVMVDQHTVTLPFLREPLLYIELRGHTVILHAQPGLQVLWDGQSQVEVRVPSSYRGQTCGLCGNFNGFAQDDLQGPDGRLLPTEASFGNSWKVPKGLGPGRPCSAGREVDPCRAAGYRARREANARCGILKTSPFSHCHAV
Construction	1085-1425 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Kielin/chordin-like protein 1 (KCP-1), Kielin/chordin-like protein, Kcp1, Kcp, Cysteine-rich motor neuron 2 protein (CRIM-2), Cysteine-rich BMP regulator 2, Crim2
Research Background	Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways.

Chemical Properties

Molecular Weight

44.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.