Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

KCNMA1 Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01028 Copy Product Info
KCNMA1 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 17.2 kDa and the accession number is Q12791.

KCNMA1 Protein, Human, Recombinant

Catalog No. TMPH-01028
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

KCNMA1 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 17.2 kDa and the accession number is Q12791.

KCNMA1 Protein, Human, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$18520 days20 days
10 μg$29720 days20 days
20 μg$51520 days20 days
50 μg$71320 days20 days
100 μg$91620 days20 days
200 μg$1,26020 days20 days
500 μg$1,93020 days20 days
1 mg$2,69020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
KCNMA1 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 17.2 kDa and the accession number is Q12791.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberQ12791
Synonyms
Slowpoke homolog (Slo homolog;hSlo),Slo-alpha,Slo1,SLO,Maxi K channel (MaxiK),KCNMA1,KCNMA,KCa1.1,K(VCA)alpha,Calcium-activated potassium channel, subfamily M subunit alpha-1,Calcium-activated potassium channel subunit alpha-1,BKCA alpha,BK channel
Amino Acid
VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
Construction
411-560 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight17.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca(2+), caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX).

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords