Shopping Cart
Remove All
Your shopping cart is currently empty
KCNMA1 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 17.2 kDa and the accession number is Q12791.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $185 | 20 days | 20 days | |
| 10 μg | $297 | 20 days | 20 days | |
| 20 μg | $515 | 20 days | 20 days | |
| 50 μg | $713 | 20 days | 20 days | |
| 100 μg | $916 | 20 days | 20 days | |
| 200 μg | $1,260 | 20 days | 20 days | |
| 500 μg | $1,930 | 20 days | 20 days | |
| 1 mg | $2,690 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | KCNMA1 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 17.2 kDa and the accession number is Q12791. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q12791 |
| Synonyms | Slowpoke homolog (Slo homolog;hSlo),Slo-alpha,Slo1,SLO,Maxi K channel (MaxiK),KCNMA1,KCNMA,KCa1.1,K(VCA)alpha,Calcium-activated potassium channel, subfamily M subunit alpha-1,Calcium-activated potassium channel subunit alpha-1,BKCA alpha,BK channel |
| Amino Acid | VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA |
| Construction | 411-560 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 17.2 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca(2+), caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX). |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.