Shopping Cart
- Remove All
- Your shopping cart is currently empty
JAM-A Protein, Feline, Recombinant (His) is expressed in E. coli. The accession number is Q2WGK2.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $266 | 20 days | |
100 μg | $498 | 20 days | |
1 mg | $2,130 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | JAM-A Protein, Feline, Recombinant (His) is expressed in E. coli. The accession number is Q2WGK2. |
Species | Feline |
Expression System | E. coli |
Tag | C-6xHis |
Accession Number | Q2WGK2 |
Synonyms | Junctional adhesion molecule A,Junctional adhesion molecule 1 (JAM-1),JAM-A,JAM1,F11R,CD321 |
Amino Acid | AVYTSEPDVRVPEDKPAKLSCSYSGFSNPRVEWKFAHGDITSLVCYKNKITASYADRVTFSHSGITFHSVTRKDTGTYTCMVSDDGGNTYGEVSVQLTVLVPPSKPTVHIPSSATIGSRAVLTCSEKDGSPPSEYYWFKDGVRMPLEPKGNRAFSNSSYSLNEKTGELVFDPVSAWDTGEYTCEAQNGYGMPMRSEAVRMEAAELNVGG |
Construction | 29-237 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 29.7 kDa (Predicted) |
Endotoxin | Not tested. |
Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 399 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.