Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IpaB Protein, Shigella flexneri, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03506

IpaB Protein, Shigella flexneri, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 40.6?kDa and the accession number is P18011.

IpaB Protein, Shigella flexneri, Recombinant (His)

IpaB Protein, Shigella flexneri, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03506
IpaB Protein, Shigella flexneri, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 40.6?kDa and the accession number is P18011.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IpaB Protein, Shigella flexneri, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 40.6?kDa and the accession number is P18011.
Species
Shigella flexneri
Expression System
E. coli
TagN-6xHis
Accession NumberP18011
Synonyms
Type 3 secretion system translocon protein SctE,T3SS translocon protein SctE,sctE,ipaB,Invasin IpaB,62 kDa antigen
Amino Acid
MHNVSTTTTGFPLAKILTSTELGDNTIQAANDAANKLFSLTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMGCVGK
Construction
1-312 aa
Protein Purity
> 85% as determined by SDS-PAGE.
IpaB Protein, Shigella flexneri, Recombinant (His)
Molecular Weight40.6?kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. Forms a pore with IpaC, which is inserted into the host cell membrane through the Mxi/Spa apparatus, during cell contact. This pore probably allows the translocation of IpaA. IpaB has also been found to be necessary and sufficient to activate macrophage apoptosis by binding to interleukin-1 beta converting enzyme (ICE). Has also been shown to be important, along with IpaD, to block or regulate secretion through the Mxi/Spa translocon in the presence or absence of the secretion signal, respectively. Through interaction with host human MAD2L2, constitutively activates the anaphase-promoting complex APC and induces a cell cycle arrest to prevent epithelial renewal in order to promote bacterial colonization.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords