Shopping Cart
Remove All
Your shopping cart is currently empty
Inhibin alpha chain/INHA Protein, Bovine, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.6 kDa and the accession number is P07994.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | - | In Stock | |
| 50 μg | $543 | 20 days | 20 days | |
| 100 μg | $745 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Inhibin alpha chain/INHA Protein, Bovine, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.6 kDa and the accession number is P07994. |
| Species | Bovine |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P07994 |
| Synonyms | Inhibin alpha chain,INHA |
| Amino Acid | STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI |
| Construction | 227-360 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 30.6 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing PBS, 6% Trehalose, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.