Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His)

Catalog No. TMPH-02359

Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.4 kDa and the accession number is P08014.

Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His)

Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His)

Catalog No. TMPH-02359
Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.4 kDa and the accession number is P08014.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.4 kDa and the accession number is P08014.
Species
Influenza B
Expression System
E. coli
TagN-6xHis
Accession NumberP08014
Synonyms
Nuclear export protein,NS,Non-structural protein 2 (NS2),NEP
Amino Acid
MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL
Construction
1-122 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight18.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Mediates the nuclear export of encapsidated genomic RNAs (ribonucleoproteins, RNPs). Acts as an adapter between viral RNPs complexes and the nuclear export machinery of the cell. Possesses no intrinsic RNA-binding activity, but includes a C-terminal M1-binding domain. This domain is believed to allow recognition of RNPs bound to the protein M1. Since protein M1 is not available in large quantities before late stages of infection, such an indirect recognition mechanism probably ensures that genomic RNPs are not exported from the host nucleus until sufficient quantities of viral mRNA and progeny genomic RNA have been synthesized. Furthermore, the RNPs enter the host cytoplasm only when associated with the M1 protein that is necessary to guide them to the plasma membrane. May down-regulate viral RNA synthesis when overproduced.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords