Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02359

Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.4 kDa and the accession number is P08014.

Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His)

Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02359
Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.4 kDa and the accession number is P08014.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Influenza B (strain B/Yamagata/1/1973) Nuclear export Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.4 kDa and the accession number is P08014.
Species
Influenza B
Expression System
E. coli
TagN-6xHis
Accession NumberP08014
Synonyms
Nuclear export protein,NS,Non-structural protein 2 (NS2),NEP
Amino Acid
MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL
Construction
1-122 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight18.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Mediates the nuclear export of encapsidated genomic RNAs (ribonucleoproteins, RNPs). Acts as an adapter between viral RNPs complexes and the nuclear export machinery of the cell. Possesses no intrinsic RNA-binding activity, but includes a C-terminal M1-binding domain. This domain is believed to allow recognition of RNPs bound to the protein M1. Since protein M1 is not available in large quantities before late stages of infection, such an indirect recognition mechanism probably ensures that genomic RNPs are not exported from the host nucleus until sufficient quantities of viral mRNA and progeny genomic RNA have been synthesized. Furthermore, the RNPs enter the host cytoplasm only when associated with the M1 protein that is necessary to guide them to the plasma membrane. May down-regulate viral RNA synthesis when overproduced.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords