Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

IL-18 Protein, Canine, Recombinant (C-His)

Catalog No. TMPH-04744

IL-18 Protein, Canine, Recombinant (His) is expressed in E. coli. The accession number is Q9XSR0.

IL-18 Protein, Canine, Recombinant (C-His)

IL-18 Protein, Canine, Recombinant (C-His)

Catalog No. TMPH-04744
IL-18 Protein, Canine, Recombinant (His) is expressed in E. coli. The accession number is Q9XSR0.
Pack SizePriceAvailabilityQuantity
20 μg$39320 days
100 μg$75620 days
1 mg$2,55020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IL-18 Protein, Canine, Recombinant (His) is expressed in E. coli. The accession number is Q9XSR0.
Species
Canine
Expression System
E. coli
TagC-6xHis
Accession NumberQ9XSR0
Synonyms
Interleukin-18,Interleukin-1 gamma (IL-1 gamma),Interferon gamma-inducing factor (IFN-gamma-inducing factor),IL-18,IL18,IGIF
Amino Acid
YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS
Construction
37-193 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight24.9 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 381 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords