IGFL1 Protein, Human, Recombinant (hFc)

Name: IGFL1 Protein, Human, Recombinant (hFc)
Brand: TargetMol
SKU: TMPH-04627
Rating: 4.5 (1 reviews)

(Synonyms: Insulin growth factor-like family member 1, IGFL1) Copy Product Info

Synonyms: Insulin growth factor-like family member 1, IGFL1

Catalog No. TMPH-04627 Copy Product Info

IGFL1 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q6UW32.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$56	20 days	20 days
10 μg	$88	20 days	20 days
20 μg	$143	20 days	20 days
50 μg	$238	20 days	20 days
100 μg	$357	20 days	20 days
200 μg	$643	20 days	20 days
500 μg	$1,390	20 days	20 days
1 mg	$2,580	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.
Description	IGFL1 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q6UW32.
Species	Human
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	Q6UW32
Amino Acid	APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Construction	25-110 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 264 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Insulin growth factor-like family member 1, IGFL1

Chemical Properties

Molecular Weight

38.7 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

IGFL-1

Related Tags: IGFL1 Protein, Human, Recombinant (hFc) chemical structure | IGFL1 Protein, Human, Recombinant (hFc) molecular weight