IGFL1 Protein, Human, Recombinant (hFc)

Catalog No. TMPH-04627

IGFL1 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q6UW32.

IGFL1 Protein, Human, Recombinant (hFc)

Catalog No. TMPH-04627

IGFL1 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q6UW32.

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$56	20 days	20 days
10 μg	$88	20 days	20 days
20 μg	$143	20 days	20 days
50 μg	$238	20 days	20 days
100 μg	$357	20 days	20 days
200 μg	$643	20 days	20 days
500 μg	$1,390	20 days	20 days
1 mg	$2,580	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.
Description	IGFL1 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q6UW32.
Species	Human
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	Q6UW32
Synonyms	Insulin growth factor-like family member 1,IGFL1
Amino Acid	APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Construction	25-110 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Molecular Weight	38.7 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 264 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

IGFL-1