Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IGFL1 Protein, Human, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04627 Copy Product Info
IGFL1 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q6UW32.

IGFL1 Protein, Human, Recombinant (hFc)

Catalog No. TMPH-04627
Copy Product Info
TargetMol | SPR

IGFL1 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q6UW32.

IGFL1 Protein, Human, Recombinant (hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$5620 days20 days
10 μg$8820 days20 days
20 μg$14320 days20 days
50 μg$23820 days20 days
100 μg$35720 days20 days
200 μg$64320 days20 days
500 μg$1,39020 days20 days
1 mg$2,58020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.
Description
IGFL1 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q6UW32.
Species
Human
Expression System
HEK293 Cells
TagC-hFc
Accession NumberQ6UW32
Synonyms
Insulin growth factor-like family member 1,IGFL1
Amino Acid
APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Construction
25-110 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight38.7 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 264 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords