Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IFN-beta Protein, Chicken, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00374 Copy Product Info
Has antiviral activities. IFN-beta Protein, Chicken, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.8 kDa and the accession number is Q90873.

IFN-beta Protein, Chicken, Recombinant (His)

Catalog No. TMPH-00374
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Has antiviral activities. IFN-beta Protein, Chicken, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.8 kDa and the accession number is Q90873.

IFN-beta Protein, Chicken, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Has antiviral activities. IFN-beta Protein, Chicken, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.8 kDa and the accession number is Q90873.
Species
Chicken
Expression System
E. coli
TagN-6xHis
Accession NumberQ90873
Synonyms
Interferon type B,IFN-beta,IFNB,IFN2
Amino Acid
CNHLRHQDANFSWKSLQLLQNTAPPPPQPCPQQDVTFPFPETLLKSKDKKQAAITTLRILQHLFNMLSSPHTPKHWIDRTRHSLLNQIQHYIHHLEQCFVNQGTRSQRRGPRNAHLSINKYFRSIHNFLQHNNYSACTWDHVRLQARDCFRHVDTLIQWMKSRAPLTASSKRLNTQ
Construction
28-203 aa
Protein Purity
> 85% as determined by SDS-PAGE.
IFN-beta Protein, Chicken, Recombinant (His)
Molecular Weight24.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Has antiviral activities.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords