IAP-1 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03320

Alkaline phosphatase that can hydrolyze various phosphate compounds. IAP-1 Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 55.9 kDa and the accession number is P15693.

IAP-1 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03320

Pack Size	Price	Availability
5 μg	$43	20 days
10 μg	$66	20 days
20 μg	$106	20 days
50 μg	$189	20 days
100 μg	$297	20 days
200 μg	$519	20 days
500 μg	$1,090	20 days
1 mg	$1,930	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37°C, pH 10.0. The specific activity is >10370.37 U/mg.
Description	Alkaline phosphatase that can hydrolyze various phosphate compounds. IAP-1 Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 55.9 kDa and the accession number is P15693.
Species	Rat
Expression System	HEK293 Cells
Tag	N-10xHis
Accession Number	P15693
Synonyms	Intestinal-type alkaline phosphatase 1,Intestinal alkaline phosphatase I (IAP-I),Intestinal alkaline phosphatase 1,IAP-1,Alpi
Amino Acid	VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN
Construction	21-511 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Molecular Weight	55.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Alkaline phosphatase that can hydrolyze various phosphate compounds.