Shopping Cart
Remove All
Your shopping cart is currently empty
Alkaline phosphatase that can hydrolyze various phosphate compounds. IAP-1 Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 55.9 kDa and the accession number is P15693.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $43 | 20 days | 20 days | |
| 10 μg | $66 | 20 days | 20 days | |
| 20 μg | $106 | 20 days | 20 days | |
| 50 μg | $189 | 20 days | 20 days | |
| 100 μg | $297 | 20 days | 20 days | |
| 200 μg | $519 | 20 days | 20 days | |
| 500 μg | $1,090 | 20 days | 20 days | |
| 1 mg | $1,930 | 20 days | 20 days |
| Biological Activity | Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37°C, pH 10.0. The specific activity is >10370.37 U/mg. |
| Description | Alkaline phosphatase that can hydrolyze various phosphate compounds. IAP-1 Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 55.9 kDa and the accession number is P15693. |
| Species | Rat |
| Expression System | HEK293 Cells |
| Tag | N-10xHis |
| Accession Number | P15693 |
| Synonyms | Intestinal-type alkaline phosphatase 1,Intestinal alkaline phosphatase I (IAP-I),Intestinal alkaline phosphatase 1,IAP-1,Alpi |
| Amino Acid | VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN |
| Construction | 21-511 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Molecular Weight | 55.9 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Alkaline phosphatase that can hydrolyze various phosphate compounds. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.