Home Tools
Log in
Cart

IAP-1 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03320

IAP-1 Protein, Rat, Recombinant (His) is expressed in HEK293.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
IAP-1 Protein, Rat, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 295.00
100 μg 20 days $ 481.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description IAP-1 Protein, Rat, Recombinant (His) is expressed in HEK293.
Species Rat
Expression System HEK293
Tag N-terminal 10xHis-tagged
Accession Number P15693
Amino Acid VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN
Construction 21-511 aa
Protein Purity > 95% as determined by SDS-PAGE.
Molecular Weight 55.9 kDa (predicted)
Endotoxin < 1.0 EU per μg protein as determined by the LAL method.
Formulation Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Alkaline phosphatase that can hydrolyze various phosphate compounds.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol