Shopping Cart
Remove All
Your shopping cart is currently empty
IAA17 Protein, Arabidopsis thaliana, Recombinant (His & Myc)
(Synonyms: Indoleacetic acid-induced protein 17, IAA17, AXR3, Auxin-responsive protein IAA17, Auxin response 3) Copy Product InfoSynonyms: Indoleacetic acid-induced protein 17, IAA17, AXR3, Auxin-responsive protein IAA17, Auxin response 3
Catalog No. TMPH-00077 Copy Product Info
Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression. IAA17 Protein, Arabidopsis thaliana, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 32.3 kDa and the accession number is P93830.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $543 | 20 days | 20 days | |
| 100 μg | $745 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression. IAA17 Protein, Arabidopsis thaliana, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 32.3 kDa and the accession number is P93830. |
| Species | Arabidopsis thaliana |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P93830 |
| Amino Acid | MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA |
| Construction | 1-229 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Indoleacetic acid-induced protein 17, IAA17, AXR3, Auxin-responsive protein IAA17, Auxin response 3 |
| Research Background |
| Molecular Weight | 32.3 kDa (predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Keywords
Preview
Related Tags: IAA17 Protein, Arabidopsis thaliana, Recombinant (His & Myc) chemical structure | IAA17 Protein, Arabidopsis thaliana, Recombinant (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.