Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Human cytomegalovirus (HCMV) (strain Merlin) Viral interleukin-10 homolog

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01195 Copy Product Info
Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells. Human cytomegalovirus (HCMV) (strain Merlin) Viral interleukin-10 homolog is expressed in E. coli expression system. The predicted molecular weight is 17.5 kDa and the accession number is F5HC71.

Human cytomegalovirus (HCMV) (strain Merlin) Viral interleukin-10 homolog

Catalog No. TMPH-01195
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells. Human cytomegalovirus (HCMV) (strain Merlin) Viral interleukin-10 homolog is expressed in E. coli expression system. The predicted molecular weight is 17.5 kDa and the accession number is F5HC71.

Human cytomegalovirus (HCMV) (strain Merlin) Viral interleukin-10 homolog
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$15820 days20 days
10 μg$26220 days20 days
20 μg$43920 days20 days
50 μg$59820 days20 days
100 μg$75820 days20 days
200 μg$1,08020 days20 days
500 μg$1,83020 days20 days
1 mg$2,69020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells. Human cytomegalovirus (HCMV) (strain Merlin) Viral interleukin-10 homolog is expressed in E. coli expression system. The predicted molecular weight is 17.5 kDa and the accession number is F5HC71.
Species
HCMV
Expression System
E. coli
TagTag Free
Accession NumberF5HC71
Synonyms
Viral interleukin-10 homolog,vIL-10,UL111A,cmvIL-10
Amino Acid
ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK
Construction
26-176 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight17.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords