Human coronavirus HKU1 (isolate N1) Spike glycoprotein (His & Myc)

Catalog No. TMPH-01149

Human coronavirus HKU1 (isolate N1) Spike glycoprotein (His & Myc) is expressed in E. coli.

Human coronavirus HKU1 (isolate N1) Spike glycoprotein (His & Myc)

Catalog No. TMPH-01149

Human coronavirus HKU1 (isolate N1) Spike glycoprotein (His & Myc) is expressed in E. coli.

Pack Size	Price	Availability
5 μg	$129	20 days
10 μg	$216	20 days
20 μg	$360	20 days
50 μg	$543	20 days
100 μg	$745	20 days
200 μg	$1,070	20 days
500 μg	$1,730	20 days
1 mg	$2,530	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Human coronavirus HKU1 (isolate N1) Spike glycoprotein (His & Myc) is expressed in E. coli.
Species	HCoV-HKU1
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	Q5MQD0
Synonyms	Spike glycoprotein,S glycoprotein,Peplomer protein,E2
Amino Acid	SGFTVKPVATVHRRIPDLPDCDIDKWLNNFNVPSPLNWERKIFSNCNFNLSTLLRLVHTDSFSCNNFDESKIYGSCFKSIVLDKFAIPNSRRSDLQLGSSGFLQSSNYKIDTTSSSCQLYYSLPAINVTINNYNPSSWNRRYGFNNFNLSSHSVVYSRYCFSVNNTFCPCAKPSFASSCKSHKPPSASCPIGTNYRSCESTTVLDHTDWCRCSCLPDPITAYDPRSCSQKKSLVGVGEHCAGFGVDEEKCGVLDGSYNVSCLCSTDAFLGWSYDTCVSNNRCNIFSNFILNGINSGTTCSNDLLQPNTEVFTDVCVDYDLYGITGQGIFKEVSAVYYNSWQNLLYDSNGNIIGFKDFVTNKTYNIFPCYAG
Construction	307-677 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	46.5 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.