Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Human coronavirus HKU1 (isolate N1) Non-structural protein 4 (Baculovirus, His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01144

Human coronavirus HKU1 (isolate N1) Non-structural protein 4 (Baculovirus, His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 13.6 kDa and the accession number is Q5MQC9.

Human coronavirus HKU1 (isolate N1) Non-structural protein 4 (Baculovirus, His)

Human coronavirus HKU1 (isolate N1) Non-structural protein 4 (Baculovirus, His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01144
Human coronavirus HKU1 (isolate N1) Non-structural protein 4 (Baculovirus, His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 13.6 kDa and the accession number is Q5MQC9.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$17620 days20 days
10 μg$29320 days20 days
20 μg$49120 days20 days
50 μg$92620 days20 days
100 μg$1,50020 days20 days
200 μg$1,75020 days20 days
500 μg$2,15020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Human coronavirus HKU1 (isolate N1) Non-structural protein 4 (Baculovirus, His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 13.6 kDa and the accession number is Q5MQC9.
Species
HCoV-HKU1
Expression System
Baculovirus Insect Cells
TagC-6xHis
Accession NumberQ5MQC9
Synonyms
Orf4 protein,ns4,Non-structural protein of 12.5 kDa (ns12.5),Non-structural protein 4,Accessory protein 4
Amino Acid
MDVWRPSYTHSLVIREFGVTNLEDLCLKYNYCQPIVGYCIVPLNVWCRKFGKFASHFTLRSHDISHSNNFGVVTSFTTYGNTVSEAVSRLVESASEFIVWRAEALNKYG
Construction
1-109 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight13.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords