Human coronavirus HKU1 (isolate N1) Non-structural protein 4 (Baculovirus, His)

Copy Product Info

Catalog No. TMPH-01144

Human coronavirus HKU1 (isolate N1) Non-structural protein 4 (Baculovirus, His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 13.6 kDa and the accession number is Q5MQC9.

Human coronavirus HKU1 (isolate N1) Non-structural protein 4 (Baculovirus, His)

Copy Product Info

Catalog No. TMPH-01144

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$176	20 days	20 days
10 μg	$293	20 days	20 days
20 μg	$491	20 days	20 days
50 μg	$926	20 days	20 days
100 μg	$1,500	20 days	20 days
200 μg	$1,750	20 days	20 days
500 μg	$2,150	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Human coronavirus HKU1 (isolate N1) Non-structural protein 4 (Baculovirus, His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 13.6 kDa and the accession number is Q5MQC9.
Species	HCoV-HKU1
Expression System	Baculovirus Insect Cells
Tag	C-6xHis
Accession Number	Q5MQC9
Synonyms	Orf4 protein,ns4,Non-structural protein of 12.5 kDa (ns12.5),Non-structural protein 4,Accessory protein 4
Amino Acid	MDVWRPSYTHSLVIREFGVTNLEDLCLKYNYCQPIVGYCIVPLNVWCRKFGKFASHFTLRSHDISHSNNFGVVTSFTTYGNTVSEAVSRLVESASEFIVWRAEALNKYG
Construction	1-109 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	13.6 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	N/A