Home Tools
Log in
Cart

HRP1 Protein, Mycobacterium tuberculosis, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-03013

Unlike some other CBS-domain containing proteins does not seem to bind AMP.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
HRP1 Protein, Mycobacterium tuberculosis, Recombinant (His & Myc & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Unlike some other CBS-domain containing proteins does not seem to bind AMP.
Species Mycobacterium tuberculosis
Expression System E. coli
Tag N-10xHis-SUMO, C-Myc
Accession Number P9WJA3
Amino Acid MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
Construction 1-143 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 35.5 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Unlike some other CBS-domain containing proteins does not seem to bind AMP.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol