Shopping Cart
Remove All
Your shopping cart is currently empty
HIV-1 (group M, subtype K, isolate 96CM-MP535) Protein Vpr (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 18.8 kDa and the accession number is P0C1P2.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $105 | 20 days | 20 days | |
| 10 μg | $169 | 20 days | 20 days | |
| 20 μg | $283 | 20 days | 20 days | |
| 50 μg | $428 | 20 days | 20 days | |
| 100 μg | $590 | 20 days | 20 days | |
| 200 μg | $913 | 20 days | 20 days | |
| 500 μg | $1,620 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | HIV-1 (group M, subtype K, isolate 96CM-MP535) Protein Vpr (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 18.8 kDa and the accession number is P0C1P2. |
| Species | HIV-1 |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P0C1P2 |
| Synonyms | vpr,Viral protein R,R ORF protein,Protein Vpr |
| Amino Acid | MEQAPEDQGPQREPNNEWTLEILEELKREAVRHFPRPWLHNLGQHIYTTYGDTWEGLEAIIRILQQLLFIHFRIGCHHSRIGIIPQRRGRNGSSRS |
| Construction | 1-96 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 18.8 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | During virus replication, may deplete host UNG protein, and incude G2-M cell cycle arrest. Acts by targeting specific host proteins for degradation by the 26S proteasome, through association with the cellular CUL4A-DDB1 E3 ligase complex by direct interaction with host VPRPB/DCAF-1. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting that it is initiated by the VPR carried into the virion. Additionally, VPR induces apoptosis in a cell cycle dependent manner suggesting that these two effects are mechanistically linked. Detected in the serum and cerebrospinal fluid of AIDS patient, VPR may also induce cell death to bystander cells.; During virus entry, plays a role in the transport of the viral pre-integration (PIC) complex to the host nucleus. This function is crucial for viral infection of non-dividing macrophages. May act directly at the nuclear pore complex, by binding nucleoporins phenylalanine-glycine (FG)-repeat regions. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.