Shopping Cart
Remove All
Your shopping cart is currently empty
Histone H4 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P62805.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $516 | 20 days | 20 days | |
| 100 μg | $678 | 20 days | 20 days | |
| 200 μg | $978 | 20 days | 20 days | |
| 500 μg | $1,590 | 20 days | 20 days | |
| 1 mg | $2,300 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | Histone H4 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P62805. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | P62805 |
| Synonyms | Histone H4,HIST4H4,HIST2H4B,HIST2H4A,HIST2H4,HIST1H4L,HIST1H4K,HIST1H4J,HIST1H4I,HIST1H4H,HIST1H4F,HIST1H4E,HIST1H4D,HIST1H4C,HIST1H4B,HIST1H4A,H4FO,H4FN,H4FM,H4FK,H4FJ,H4FI,H4FH,H4FG,H4FE,H4FD,H4FC,H4FB,H4FA,H4F2,H4C9,H4C8,H4C6,H4C5,H4C4,H4C3,H4C2,H4C16,H4C15,H4C14,H4C13,H4C12,H4C11,H4C1,H4-16,H4/O,H4/N,H4/M,H4/K,H4/J,H4/I,H4/H,H4/G,H4/E,H4/D,H4/C,H4/B,H4/A |
| Amino Acid | SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
| Construction | 2-103 aa |
| Protein Purity | >85% as determined by SDS-PAGE. |
| Molecular Weight | 18.1 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.