Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

HAT1 Protein, Human, Recombinant (His)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04810

HAT1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is O14929.

HAT1 Protein, Human, Recombinant (His)

HAT1 Protein, Human, Recombinant (His)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04810
HAT1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is O14929.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$251InquiryInquiry
10 μg$398InquiryInquiry
20 μg$642InquiryInquiry
50 μg$1,160InquiryInquiry
100 μg$1,850InquiryInquiry
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
HAT1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is O14929.
Species
Human
Expression System
E. coli
TagN-6xHis
Accession NumberO14929
Synonyms
KAT1,Histone acetyltransferase type B catalytic subunit,Histone acetyltransferase 1,HAT1
Amino Acid
KKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMVIEAQQKFKINKQHARRVYEILRLLVTD
Construction
20-341 aa
Protein Purity
> 85% as determined by SDS-PAGE.
HAT1 Protein, Human, Recombinant (His)
Molecular Weight44.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords