GUCA2B Protein, Human, Recombinant (His)

Catalog No. TMPH-01424 Copy Product Info

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport. GUCA2B Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 13.5 kDa and the accession number is Q16661.

GUCA2B Protein, Human, Recombinant (His)

Catalog No. TMPH-01424

Copy Product Info

GUCA2B Protein, Human, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	-	In Stock
10 μg	$238	20 days	20 days
20 μg	$397	-	In Stock
50 μg	$759	20 days	20 days
100 μg	$1,250	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport. GUCA2B Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 13.5 kDa and the accession number is Q16661.
Species	Human
Expression System	HEK293 Cells
Tag	N-6xHis
Accession Number	Q16661
Synonyms	GUCA2B,Guanylate cyclase activator 2B
Amino Acid	VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Construction	27-112 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	13.5 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.