Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

GST Protein, Plasmodium falciparum, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03138

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May also function as a storage protein or ligandin for parasitotoxic ferriprotoporphyrin IX (hemin). GST Protein, Plasmodium falciparum, Recombinant (His) is expressed in yeast with N-10xHis tag. The predicted molecular weight is 27.3 kDa and the accession number is Q8MU52.

GST Protein, Plasmodium falciparum, Recombinant (His)

GST Protein, Plasmodium falciparum, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03138
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May also function as a storage protein or ligandin for parasitotoxic ferriprotoporphyrin IX (hemin). GST Protein, Plasmodium falciparum, Recombinant (His) is expressed in yeast with N-10xHis tag. The predicted molecular weight is 27.3 kDa and the accession number is Q8MU52.
Pack SizePriceAvailabilityQuantity
5 μg$14320 days
10 μg$23820 days
20 μg$39720 days
50 μg$59720 days
100 μg$84520 days
200 μg$1,19020 days
500 μg$1,95020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May also function as a storage protein or ligandin for parasitotoxic ferriprotoporphyrin IX (hemin). GST Protein, Plasmodium falciparum, Recombinant (His) is expressed in yeast with N-10xHis tag. The predicted molecular weight is 27.3 kDa and the accession number is Q8MU52.
Species
Plasmodium falciparum
Expression System
P. pastoris (Yeast)
TagN-10xHis
Accession NumberQ8MU52
Synonyms
GST
Amino Acid
MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY
Construction
1-211 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight27.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May also function as a storage protein or ligandin for parasitotoxic ferriprotoporphyrin IX (hemin).

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.