Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

GRO gama/CXCL3 Protein, Mouse, Recombinant

TargetMol | SPR
Catalog No. TMPH-04250 Copy Product Info
GRO gama/CXCL3 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q6W5C0.

GRO gama/CXCL3 Protein, Mouse, Recombinant

Catalog No. TMPH-04250
Copy Product Info
TargetMol | SPR

GRO gama/CXCL3 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q6W5C0.

GRO gama/CXCL3 Protein, Mouse, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$2237-10 days7-10 days
10 μg$3687-10 days7-10 days
20 μg$5297-10 days7-10 days
50 μg$8487-10 days7-10 days
100 μg$1,2207-10 days7-10 days
200 μg$1,7207-10 days7-10 days
500 μg$2,7307-10 days7-10 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml.
Description
GRO gama/CXCL3 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q6W5C0.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberQ6W5C0
Synonyms
Gm1960,Dendritic cell inflammatory protein 1,Dcip1,Cxcl3,C-X-C motif chemokine 3
Amino Acid
AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Construction
28-100 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight7.9 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords