Granzyme B Protein, Human, Recombinant (E. coli, His)

Name: Granzyme B Protein, Human, Recombinant (E. coli, His)
Brand: TargetMol
SKU: TMPH-01412
Rating: 4.5 (1 reviews)

(Synonyms: T-cell serine protease 1-3E, SECT, Human lymphocyte protein (HLP), GZMB, GRB, Granzyme-2, Granzyme B, Fragmentin-2, Cytotoxic T-lymphocyte proteinase 2 (Lymphocyte protease), CTLA-1, CTLA1, CSPB, CGL1, Cathepsin G-like 1 (CTSGL1), C11) Copy Product Info

Synonyms: T-cell serine protease 1-3E, SECT, Human lymphocyte protein (HLP), GZMB, GRB, Granzyme-2, Granzyme B, Fragmentin-2, Cytotoxic T-lymphocyte proteinase 2 (Lymphocyte protease), CTLA-1, CTLA1, CSPB, CGL1, Cathepsin G-like 1 (CTSGL1), C11

Catalog No. TMPH-01412 Copy Product Info

Granzyme B Protein, Human, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.0 kDa and the accession number is P10144.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Granzyme B Protein, Human, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.0 kDa and the accession number is P10144.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P10144
Amino Acid	IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Construction	21-247 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	T-cell serine protease 1-3E, SECT, Human lymphocyte protein (HLP), GZMB, GRB, Granzyme-2, Granzyme B, Fragmentin-2, Cytotoxic T-lymphocyte proteinase 2 (Lymphocyte protease), CTLA-1, CTLA1, CSPB, CGL1, Cathepsin G-like 1 (CTSGL1), C11
Research Background	Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse. It cleaves after Asp. Once delivered into the target cell, acts by catalyzing cleavage of gasdermin-E (GSDME), releasing the pore-forming moiety of GSDME, thereby triggering pyroptosis and target cell death. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.

Chemical Properties

Molecular Weight

31.0 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

Lymphocyte proteaseHLPGranzymeBGranzyme2Fragmentin2CTSGL1CTSGL 1CTLA 1CGL 1C 11

Related Tags: Granzyme B Protein, Human, Recombinant (E. coli, His) chemical structure | Granzyme B Protein, Human, Recombinant (E. coli, His) molecular weight