Shopping Cart
Remove All
Your shopping cart is currently empty
Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM. GRA3 Protein, Toxoplasma gondii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 10.8 kDa and the accession number is B6KEU8.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $543 | 20 days | 20 days | |
| 100 μg | $745 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM. GRA3 Protein, Toxoplasma gondii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 10.8 kDa and the accession number is B6KEU8. |
| Species | Toxoplasma gondii |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | B6KEU8 |
| Synonyms | Tg556,P30,GRA3,Dense granule protein 3 |
| Amino Acid | ADQPENHQALAEPVTGVGEAGVSPVNEAGESYSSATSGVQEATAPGAVLLDAIDAESDKVDNQAEGGERMKK |
| Construction | 43-114 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 10.8 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.