Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

GRA3 Protein, Toxoplasma gondii, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03634 Copy Product Info
Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM. GRA3 Protein, Toxoplasma gondii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 10.8 kDa and the accession number is B6KEU8.

GRA3 Protein, Toxoplasma gondii, Recombinant (His)

Catalog No. TMPH-03634
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM. GRA3 Protein, Toxoplasma gondii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 10.8 kDa and the accession number is B6KEU8.

GRA3 Protein, Toxoplasma gondii, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM. GRA3 Protein, Toxoplasma gondii, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 10.8 kDa and the accession number is B6KEU8.
Species
Toxoplasma gondii
Expression System
E. coli
TagN-6xHis
Accession NumberB6KEU8
Synonyms
Tg556,P30,GRA3,Dense granule protein 3
Amino Acid
ADQPENHQALAEPVTGVGEAGVSPVNEAGESYSSATSGVQEATAPGAVLLDAIDAESDKVDNQAEGGERMKK
Construction
43-114 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight10.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords