Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His)

Catalog No. TMPH-00488

Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His) is expressed in Yeast.

Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His)

Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His)

Catalog No. TMPH-00488
Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His) is expressed in Yeast.
Pack SizePriceAvailabilityQuantity
20 μg $39720 days
100 μg $84520 days
1 mg $2,97020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His) is expressed in Yeast.
Species
Canine
Expression System
P. pastoris (Yeast)
TagC-10xHis
Accession NumberQ9XSW8
Synonyms
Thyrotropin alpha chain,Thyroid-stimulating hormone alpha chain (TSH-alpha),Lutropin alpha chain,Luteinizing hormone alpha chain (LSH-alpha),Glycoprotein hormones alpha chain,Follitropin alpha chain,Follicle-stimulating hormone alpha chain (FSH-alpha),CGA,Anterior pituitary glycoprotein hormones common subunit alpha
Amino Acid
FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS
Construction
25-120 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight12.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords