Glycodelin Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01402 Copy Product Info

Glycodelin Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 23.9 kDa and the accession number is P09466.

Glycodelin Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01402

Copy Product Info

Glycodelin Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 23.9 kDa and the accession number is P09466.

Pack Size	Price	USA Stock	Global Stock
5 μg	$197	20 days	20 days
10 μg	$327	20 days	20 days
20 μg	$549	20 days	20 days
50 μg	$987	20 days	20 days
100 μg	$1,690	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Glycodelin Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 23.9 kDa and the accession number is P09466.
Species	Human
Expression System	HEK293 Cells
Tag	N-10xHis, C-Myc
Accession Number	P09466
Synonyms	Zona-binding inhibitory factor-1 (ZIF-1),Progesterone-associated endometrial protein,Progestagen-associated endometrial protein,Pregnancy-associated endometrial alpha-2 globulin (PAEG;PEG),Placental protein 14 (PP14),PAEP,Glycodelin,GD
Amino Acid	MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Construction	19-180 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	23.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities. Glycodelin-C stimulates binding of spermatozoa to the zona pellucida. Glycodelin-F inhibits spermatozoa-zona pellucida binding and significantly suppresses progesterone-induced acrosome reaction of spermatozoa. Glycodelin-S in seminal plasma maintains the uncapacitated state of human spermatozoa.