GCGR Protein, Human, Recombinant (His & Myc)

Name: GCGR Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-01383
Rating: 4.5 (1 reviews)

(Synonyms: Glucagon receptor, GL-R, GCGR) Copy Product Info

Synonyms: Glucagon receptor, GL-R, GCGR

Catalog No. TMPH-01383 Copy Product Info

GCGR Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 18.1 kDa and the accession number is P47871.

Pack Size	Price	USA Stock	Global Stock
5 µg	$50	20 days	20 days
10 µg	$78	20 days	20 days
20 µg	$125	20 days	20 days
50 µg	$222	20 days	20 days
100 µg	$348	20 days	20 days
200 µg	$588	20 days	20 days
500 µg	$1,230	20 days	20 days
1 mg	$2,170	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody, the EC 50 is 3.747-6.666 ng/mL.
Description	GCGR Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 18.1 kDa and the accession number is P47871.
Species	Human
Expression System	HEK293 Cells
Tag	N-10xHis, C-Myc
Accession Number	P47871
Amino Acid	AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK
Construction	26-136 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Glucagon receptor, GL-R, GCGR
Research Background	G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.

Chemical Properties

Molecular Weight

18.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.