Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

FOxM1 Protein, Human, Recombinant (His & Myc & SUMO)

FOxM1 Protein, Human, Recombinant (His & Myc & SUMO)
Resource Download

FOxM1 Protein, Human, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-01351
Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. FOxM1 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 31.2 kDa and the accession number is Q08050.
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Pack SizePriceAvailabilityQuantity
20 μg$23720 days
100 μg$44620 days
1 mg$1,92020 days
Bulk & Custom
Add to Cart
Questions
View More

Biological Description

Biological Information
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. FOxM1 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 31.2 kDa and the accession number is Q08050.
Species
Human
Expression System
E. coli
TagN-10xHis-SUMO, C-Myc
Accession NumberQ08050
Synonyms
Forkhead-related protein FKHL16,MPM-2 reactive phosphoprotein 2,Winged-helix factor from INS-1 cells,Transcription factor Trident,FOXM1,Hepatocyte nuclear factor 3 forkhead homolog 11,M-phase phosphoprotein 2,Forkhead box protein M1
Amino Acid
ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
Construction
235-327 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight31.2 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.