Shopping Cart
- Remove All
- Your shopping cart is currently empty
Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. FOxM1 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 31.2 kDa and the accession number is Q08050.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $89 | 20 days | |
10 μg | $143 | 20 days | |
20 μg | $237 | 20 days | |
50 μg | $358 | 20 days | |
100 μg | $490 | 20 days | |
200 μg | $755 | 20 days | |
500 μg | $1,330 | 20 days | |
1 mg | $2,080 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. FOxM1 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 31.2 kDa and the accession number is Q08050. |
Species | Human |
Expression System | E. coli |
Tag | N-10xHis-SUMO, C-Myc |
Accession Number | Q08050 |
Synonyms | Winged-helix factor from INS-1 cells,WIN,Transcription factor Trident,MPP2,MPM-2 reactive phosphoprotein 2,M-phase phosphoprotein 2,HFH11,Hepatocyte nuclear factor 3 forkhead homolog 11 (HFH-11;HNF-3/fork-head homolog 11),FOXM1,Forkhead-related protein FKHL16,Forkhead box protein M1,FKHL16 |
Amino Acid | ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL |
Construction | 235-327 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 31.2 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.