Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

FGF-23 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03294

Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. FGF-23 Protein, Rat, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.5 kDa and the accession number is Q8VI82.

FGF-23 Protein, Rat, Recombinant (His)

FGF-23 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03294
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. FGF-23 Protein, Rat, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.5 kDa and the accession number is Q8VI82.
Pack SizePriceAvailabilityQuantity
20 μg $33920 days
100 μg $69620 days
1 mg $2,97020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. FGF-23 Protein, Rat, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.5 kDa and the accession number is Q8VI82.
Species
Rat
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ8VI82
Synonyms
Fibroblast growth factor 23,FGF-23,Fgf23
Amino Acid
YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
Construction
25-251 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight27.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords