Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

FGF-23 Protein, Rat, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03294 Copy Product Info
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. FGF-23 Protein, Rat, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.5 kDa and the accession number is Q8VI82.

FGF-23 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03294
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. FGF-23 Protein, Rat, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.5 kDa and the accession number is Q8VI82.

FGF-23 Protein, Rat, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12320 days20 days
10 μg$19820 days20 days
20 μg$33920 days20 days
50 μg$49720 days20 days
100 μg$69620 days20 days
200 μg$1,07020 days20 days
500 μg$1,89020 days20 days
1 mg$2,97020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. FGF-23 Protein, Rat, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.5 kDa and the accession number is Q8VI82.
Species
Rat
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ8VI82
Synonyms
Fibroblast growth factor 23,FGF-23,Fgf23
Amino Acid
YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
Construction
25-251 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight27.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords