FGF-23 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03294 Copy Product Info

Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. FGF-23 Protein, Rat, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.5 kDa and the accession number is Q8VI82.

FGF-23 Protein, Rat, Recombinant (His)

Catalog No. TMPH-03294

Copy Product Info

Pack Size	Price	USA Stock	Global Stock
5 μg	$123	20 days	20 days
10 μg	$198	20 days	20 days
20 μg	$339	20 days	20 days
50 μg	$497	20 days	20 days
100 μg	$696	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,890	20 days	20 days
1 mg	$2,970	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. FGF-23 Protein, Rat, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.5 kDa and the accession number is Q8VI82.
Species	Rat
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q8VI82
Synonyms	Fibroblast growth factor 23,FGF-23,Fgf23
Amino Acid	YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
Construction	25-251 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	27.5 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.