FGF-20 Protein, Mouse, Recombinant

Catalog No. TMPH-02653

Neurotrophic factor that regulates central nervous development and function. FGF-20 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 23.6 kDa and the accession number is Q9ESL9.

FGF-20 Protein, Mouse, Recombinant

Catalog No. TMPH-02653

Pack Size	Price	Availability
5 μg	$185	20 days
10 μg	$297	20 days
20 μg	$515	20 days
50 μg	$713	20 days
100 μg	$916	20 days
200 μg	$1,260	20 days
500 μg	$1,930	20 days
1 mg	$2,690	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Neurotrophic factor that regulates central nervous development and function. FGF-20 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 23.6 kDa and the accession number is Q9ESL9.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	Q9ESL9
Synonyms	Fibroblast growth factor 20,FGF-20,Fgf20
Amino Acid	MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Construction	1-211 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	23.6 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Neurotrophic factor that regulates central nervous development and function.