Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

FGF-20 Protein, Mouse, Recombinant

Catalog No. TMPH-02653

Neurotrophic factor that regulates central nervous development and function. FGF-20 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 23.6 kDa and the accession number is Q9ESL9.

FGF-20 Protein, Mouse, Recombinant

FGF-20 Protein, Mouse, Recombinant

Catalog No. TMPH-02653
Neurotrophic factor that regulates central nervous development and function. FGF-20 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 23.6 kDa and the accession number is Q9ESL9.
Pack SizePriceAvailabilityQuantity
20 μg$51520 days
100 μg$91620 days
1 mg$2,69020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Neurotrophic factor that regulates central nervous development and function. FGF-20 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 23.6 kDa and the accession number is Q9ESL9.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberQ9ESL9
Synonyms
Fibroblast growth factor 20,FGF-20,Fgf20
Amino Acid
MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Construction
1-211 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight23.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Neurotrophic factor that regulates central nervous development and function.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords