Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Fibroblast growth factor, FGF2, FGF

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 20 µg | Inquiry | 20 days | 20 days | |
| 100 µg | Inquiry | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | FGF-2 Protein, Pig, Recombinant (His) is expressed in E. coli. The accession number is A0A287BGK8. |
| Species | Pig |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | A0A287BGK8 |
| Amino Acid | GSRSGRPRGRPQKTGASRGRRAGREEGRGRGGWWAFGGGDVEDVTPRGSAGARPADSEPAVASRSRALQFGEAALPRVAAAEKPSPNPQLQGRRRAKRPNSTRLGARGRGRVPRGGRLGGRGRGRAPERVGGRGRGSAAAAAAAPRAAPGARGPRQSPGGAMAAG |
| Construction | 1-165 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Fibroblast growth factor, FGF2, FGF |
| Molecular Weight | 20.8 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 86 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.