Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

FGF-2 Protein, Pig, Recombinant (His)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04449

FGF-2 Protein, Pig, Recombinant (His) is expressed in E. coli. The accession number is A0A287BGK8.

FGF-2 Protein, Pig, Recombinant (His)

FGF-2 Protein, Pig, Recombinant (His)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04449
FGF-2 Protein, Pig, Recombinant (His) is expressed in E. coli. The accession number is A0A287BGK8.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
20 μgInquiry20 days20 days
100 μgInquiry20 days20 days
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
FGF-2 Protein, Pig, Recombinant (His) is expressed in E. coli. The accession number is A0A287BGK8.
Species
Pig
Expression System
E. coli
TagN-6xHis
Accession NumberA0A287BGK8
Synonyms
Fibroblast growth factor,FGF2,FGF
Amino Acid
GSRSGRPRGRPQKTGASRGRRAGREEGRGRGGWWAFGGGDVEDVTPRGSAGARPADSEPAVASRSRALQFGEAALPRVAAAEKPSPNPQLQGRRRAKRPNSTRLGARGRGRVPRGGRLGGRGRGRAPERVGGRGRGSAAAAAAAPRAAPGARGPRQSPGGAMAAG
Construction
1-165 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight20.8 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 86 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords