Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

FGF-1 Protein, Bovine, Recombinant (His)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04776

FGF-1 Protein, Bovine, Recombinant (His) is expressed in Yeast. The accession number is P03968.

FGF-1 Protein, Bovine, Recombinant (His)

FGF-1 Protein, Bovine, Recombinant (His)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04776
FGF-1 Protein, Bovine, Recombinant (His) is expressed in Yeast. The accession number is P03968.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$10620 days20 days
10 μg$17220 days20 days
20 μg$28620 days20 days
50 μg$39720 days20 days
100 μg$53520 days20 days
200 μg$83720 days20 days
500 μg$1,52020 days20 days
1 mg$2,39020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
FGF-1 Protein, Bovine, Recombinant (His) is expressed in Yeast. The accession number is P03968.
Species
Bovine
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP03968
Synonyms
Prostatropin,Heparin-binding growth factor 1 (HBGF-1),HBGF-1,Fibroblast growth factor 1,FGFA,FGF-1,FGF1,Endothelial cell growth factor (ECGF),AFGF,Acidic fibroblast growth factor (aFGF),Acidic eye-derived growth factor II (EDGF II)
Amino Acid
AEGETTTFTALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQLCAESIGEVYIKSTETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKHWFVGLKKNGRSKLGPRTHFGQKAILFLPLPVSSD
Construction
2-155 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight18.8 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 413 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords