FGF-1 Protein, Bovine, Recombinant (His)

Name: FGF-1 Protein, Bovine, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04776
Rating: 4.5 (1 reviews)

(Synonyms: Prostatropin, Heparin-binding growth factor 1 (HBGF-1), HBGF-1, Fibroblast growth factor 1, FGFA, FGF-1, FGF1, Endothelial cell growth factor (ECGF), AFGF, Acidic fibroblast growth factor (aFGF), Acidic eye-derived growth factor II (EDGF II)) Copy Product Info

Synonyms: Prostatropin, Heparin-binding growth factor 1 (HBGF-1), HBGF-1, Fibroblast growth factor 1, FGFA, FGF-1, FGF1, Endothelial cell growth factor (ECGF), AFGF, Acidic fibroblast growth factor (aFGF), Acidic eye-derived growth factor II (EDGF II)

Catalog No. TMPH-04776 Copy Product Info

FGF-1 Protein, Bovine, Recombinant (His) is expressed in Yeast. The accession number is P03968.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$106	20 days	20 days
10 μg	$172	20 days	20 days
20 μg	$286	20 days	20 days
50 μg	$397	20 days	20 days
100 μg	$535	20 days	20 days
200 μg	$837	20 days	20 days
500 μg	$1,520	20 days	20 days
1 mg	$2,390	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	FGF-1 Protein, Bovine, Recombinant (His) is expressed in Yeast. The accession number is P03968.
Species	Bovine
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P03968
Amino Acid	AEGETTTFTALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQLCAESIGEVYIKSTETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKHWFVGLKKNGRSKLGPRTHFGQKAILFLPLPVSSD
Construction	2-155 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 413 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Prostatropin, Heparin-binding growth factor 1 (HBGF-1), HBGF-1, Fibroblast growth factor 1, FGFA, FGF-1, FGF1, Endothelial cell growth factor (ECGF), AFGF, Acidic fibroblast growth factor (aFGF), Acidic eye-derived growth factor II (EDGF II)

Chemical Properties

Molecular Weight

18.8 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

HBGF1

Related Tags: FGF-1 Protein, Bovine, Recombinant (His) chemical structure | FGF-1 Protein, Bovine, Recombinant (His) molecular weight