Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Fbxo3 Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02651

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.

Fbxo3 Protein, Mouse, Recombinant (His & Myc)

Fbxo3 Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02651
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.
Pack SizePriceAvailabilityQuantity
20 μg $36020 days
100 μg $74520 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.
Species
Mouse
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberQ9CPU7
Synonyms
Muscle atrophy F-box protein (MAFbx),Fbxo32,F-box only protein 32,Atrogin-1
Amino Acid
MPFLGQDWRSPGQSWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYSKENLFSSLNYDVAAKKRKKDIQNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNSIQISRPAFKGLTITDLPVCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKRLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Construction
1-355 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight48.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords