EsxH Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO)

Name: EsxH Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-03011
Rating: 4.5 (1 reviews)

(Synonyms: Protein TB10.4, Low molecular weight protein antigen 7, esxH, ESAT-6-like protein EsxH, cfp7, 10 kDa antigen CFP7 (CFP-7)) Copy Product Info

Synonyms: Protein TB10.4, Low molecular weight protein antigen 7, esxH, ESAT-6-like protein EsxH, cfp7, 10 kDa antigen CFP7 (CFP-7)

Catalog No. TMPH-03011 Copy Product Info

EsxH, in complex with EsxG, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery.

EsxH Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	EsxH, in complex with EsxG, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery.
Species	Mycobacterium tuberculosis
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P9WNK2
Amino Acid	SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
Construction	2-96 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Protein TB10.4, Low molecular weight protein antigen 7, esxH, ESAT-6-like protein EsxH, cfp7, 10 kDa antigen CFP7 (CFP-7)
Research Background	EsxH, in complex with EsxG, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery.

Chemical Properties

Molecular Weight

26.3 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

Protein TB 10.4CFP-7CFP7cfp 7

Related Tags: EsxH Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO) chemical structure | EsxH Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO) molecular weight