Shopping Cart
- Remove All
Your shopping cart is currently empty
Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1). EPFL9 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 14.2 kDa and the accession number is Q9SV72.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $129 | 20 days | |
| 10 μg | $216 | 20 days | |
| 20 μg | $360 | 20 days | |
| 50 μg | $543 | 20 days | |
| 100 μg | $745 | 20 days | |
| 200 μg | $1,070 | 20 days | |
| 500 μg | $1,730 | 20 days | |
| 1 mg | $2,530 | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1). EPFL9 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 14.2 kDa and the accession number is Q9SV72. |
| Species | Arabidopsis thaliana |
| Expression System | E. coli |
| Tag | N-10xHis |
| Accession Number | Q9SV72 |
| Synonyms | STOMAGEN,EPIDERMAL PATTERNING FACTOR-like protein 9,EPF-like protein 9,EPFL9 |
| Amino Acid | SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR |
| Construction | 32-102 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 14.2 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1). |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.