Home Tools
Log in
Cart

EPFL9 Protein, Arabidopsis thaliana, Recombinant (His)

Catalog No. TMPH-00086

Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1).

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
EPFL9 Protein, Arabidopsis thaliana, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1).
Species Arabidopsis thaliana
Expression System E. coli
Tag N-terminal 10xHis-tagged
Accession Number Q9SV72
Amino Acid SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 32-102 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 14.2 kDa (predicted)
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1).

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol