EPFL9 Protein, Arabidopsis thaliana, Recombinant (His)

Name: EPFL9 Protein, Arabidopsis thaliana, Recombinant (His)
Brand: TargetMol
SKU: TMPH-00086
Rating: 4.5 (1 reviews)

(Synonyms: STOMAGEN, EPIDERMAL PATTERNING FACTOR-like protein 9, EPF-like protein 9, EPFL9) Copy Product Info

Synonyms: STOMAGEN, EPIDERMAL PATTERNING FACTOR-like protein 9, EPF-like protein 9, EPFL9

Catalog No. TMPH-00086 Copy Product Info

Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1). EPFL9 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 14.2 kDa and the accession number is Q9SV72.

EPFL9 Protein, Arabidopsis thaliana, Recombinant (His)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	20 days	20 days
10 μg	$216	20 days	20 days
20 μg	$360	20 days	20 days
50 μg	$543	20 days	20 days
100 μg	$745	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1). EPFL9 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 14.2 kDa and the accession number is Q9SV72.
Species	Arabidopsis thaliana
Expression System	E. coli
Tag	N-10xHis
Accession Number	Q9SV72
Amino Acid	SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
Construction	32-102 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	STOMAGEN, EPIDERMAL PATTERNING FACTOR-like protein 9, EPF-like protein 9, EPFL9
Research Background

Chemical Properties

Molecular Weight

14.2 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

EPF-like protein9EPFL 9

Related Tags: EPFL9 Protein, Arabidopsis thaliana, Recombinant (His) chemical structure | EPFL9 Protein, Arabidopsis thaliana, Recombinant (His) molecular weight