Home Tools
Log in
Cart

EN1 Protein, Chicken, Recombinant (B2M & His)

Catalog No. TMPH-00372
Synonyms: EN-1, Homeobox protein en-1, Gg-En-1, Homeobox protein engrailed-1, EN1

EN1 Protein, Chicken, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 48.5 kDa and the accession number is Q05916.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
EN1 Protein, Chicken, Recombinant (B2M & His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description EN1 Protein, Chicken, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 48.5 kDa and the accession number is Q05916.
Species Chicken
Expression System E. coli
Tag N-6xHis-B2M
Accession Number Q05916
Synonyms EN-1, Homeobox protein en-1, Gg-En-1, Homeobox protein engrailed-1, EN1
Amino Acid MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE
Construction 1-333 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 48.5 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

EN1 Protein, Chicken, Recombinant (B2M & His) EN-1 Homeobox protein en-1 Gg-En-1 Homeobox protein engrailed-1 EN1 recombinant recombinant-proteins proteins protein

 

TargetMol