Home Tools
Log in
Cart

EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-02645
Synonyms: Egfl8, Epidermal growth factor-like protein 8, Ng3, EGF-like protein 8

N/A. EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 49.0 kDa and the accession number is Q6GUQ1.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 237.00
100 μg 20 days $ 446.00
1 mg 20 days $ 1,920.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description N/A. EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 49.0 kDa and the accession number is Q6GUQ1.
Species Mouse
Expression System E. coli
Tag N-10xHis-SUMO, C-Myc
Accession Number Q6GUQ1
Synonyms Egfl8, Epidermal growth factor-like protein 8, Ng3, EGF-like protein 8
Amino Acid GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG
Construction 29-293 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 49.0 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background N/A

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO) Egfl8 Epidermal growth factor-like protein 8 Ng3 EGF-like protein 8 recombinant recombinant-proteins proteins protein

 

TargetMol