Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-02645

EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 49.0 kDa and the accession number is Q6GUQ1.

EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO)

EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-02645
EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 49.0 kDa and the accession number is Q6GUQ1.
Pack SizePriceAvailabilityQuantity
20 μg$23720 days
100 μg$49020 days
1 mg$2,08020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
EGFL8 Protein, Mouse, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 49.0 kDa and the accession number is Q6GUQ1.
Species
Mouse
Expression System
E. coli
TagN-10xHis-SUMO, C-Myc
Accession NumberQ6GUQ1
Synonyms
Ng3,Epidermal growth factor-like protein 8,EGF-like protein 8,Egfl8
Amino Acid
GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG
Construction
29-293 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight49.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords