Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

EEF1AKMT2 Protein, Mouse, Recombinant (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02635

Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-318'. EEF1AKMT2 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 32.9 kDa and the accession number is Q9D853.

EEF1AKMT2 Protein, Mouse, Recombinant (His)

EEF1AKMT2 Protein, Mouse, Recombinant (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02635
Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-318'. EEF1AKMT2 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 32.9 kDa and the accession number is Q9D853.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-318'. EEF1AKMT2 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 32.9 kDa and the accession number is Q9D853.
Species
Mouse
Expression System
E. coli
TagN-10xHis
Accession NumberQ9D853
Synonyms
Protein-lysine N-methyltransferase Mettl10,Mettl10,Methyltransferase-like protein 10,Eef1akmt2,EEF1A lysine methyltransferase 2
Amino Acid
MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSFGGRSGNTVAALVFQKRGTSLDKIS
Construction
1-244 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight32.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-318'.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords