Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00427

Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII. DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 39.3 kDa and the accession number is Q487H6.

DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant

DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00427
Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII. DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 39.3 kDa and the accession number is Q487H6.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$15820 days20 days
10 μg$26220 days20 days
20 μg$43920 days20 days
50 μg$59820 days20 days
100 μg$75820 days20 days
200 μg$1,08020 days20 days
500 μg$1,83020 days20 days
1 mg$2,69020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII. DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 39.3 kDa and the accession number is Q487H6.
Species
Colwellia psychrerythraea
Expression System
E. coli
TagTag Free
Accession NumberQ487H6
Synonyms
Pol IV,DNA polymerase IV,dinB
Amino Acid
MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDISTQDECKLVIDSLYQKLLTRLAPHSNREIIRQGVKLKFTDFNQTTVETQSNECQQALFISLLSKAYSRSNKRGVRLVGLTLGFADSPGESQQLSLSL
Construction
1-352 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight39.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords