DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant

Catalog No. TMPH-00427 Copy Product Info

Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII. DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 39.3 kDa and the accession number is Q487H6.

DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant

Catalog No. TMPH-00427

Copy Product Info

DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant

Pack Size	Price	USA Stock	Global Stock
5 μg	$158	20 days	20 days
10 μg	$262	20 days	20 days
20 μg	$439	20 days	20 days
50 μg	$598	20 days	20 days
100 μg	$758	20 days	20 days
200 μg	$1,080	20 days	20 days
500 μg	$1,830	20 days	20 days
1 mg	$2,690	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII. DNA polymerase IV Protein, Colwellia psychrerythraea, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 39.3 kDa and the accession number is Q487H6.
Species	Colwellia psychrerythraea
Expression System	E. coli
Tag	Tag Free
Accession Number	Q487H6
Synonyms	Pol IV,DNA polymerase IV,dinB
Amino Acid	MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDISTQDECKLVIDSLYQKLLTRLAPHSNREIIRQGVKLKFTDFNQTTVETQSNECQQALFISLLSKAYSRSNKRGVRLVGLTLGFADSPGESQQLSLSL
Construction	1-352 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	39.3 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII.