Shopping Cart
Remove All
Your shopping cart is currently empty
Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc)
(Synonyms: NAD(+)--diphthamide ADP-ribosyltransferase, DT, Diphtheria toxin) Copy Product InfoSynonyms: NAD(+)--diphthamide ADP-ribosyltransferase, DT, Diphtheria toxin
Catalog No. TMPH-00432 Copy Product Info
Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc) is expressed in E. coli.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $129 | - | In Stock | |
| 10 µg | $216 | - | In Stock | |
| 20 µg | $360 | - | In Stock | |
| 50 µg | $543 | - | In Stock | |
| 100 µg | $745 | - | In Stock | |
| 200 µg | $1,070 | 20 days | 20 days | |
| 500 µg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:96% (SDS-PAGE)
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc) is expressed in E. coli. |
| Species | Corynephage omega |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P00587 |
| Amino Acid | GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRR |
| Construction | 26-218 aa |
| Protein Purity | > 85% as determined by SDS-PAGE.  |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | NAD(+)--diphthamide ADP-ribosyltransferase, DT, Diphtheria toxin |
| Research Background | Diphtheria toxin, produced by a phage infecting Corynebacterium diphtheriae, is a proenzyme that, after activation, catalyzes the covalent attachment of the ADP ribose moiety of NAD to elongation factor 2. Fragment A is responsible for enzymatic ADP-ribosylation of elongation factor 2, while fragment B is responsible for binding of toxin to cell receptors and entry of fragment A. |
| Molecular Weight | 28.6 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Preview
Related Tags: Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc) chemical structure | Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.