Home Tools
Log in
Cart

Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc)

Catalog No. TMPH-00432
Synonyms: Diphtheria toxin, DT, NAD(+)--diphthamide ADP-ribosyltransferase

Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc) is expressed in E. coli.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc) is expressed in E. coli.
Species Corynephage omega
Expression System E. coli
Tag N-10xHis, C-Myc
Accession Number P00587
Synonyms Diphtheria toxin, DT, NAD(+)--diphthamide ADP-ribosyltransferase
Amino Acid GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRR
Construction 26-218 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 28.6 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Diphtheria toxin, produced by a phage infecting Corynebacterium diphtheriae, is a proenzyme that, after activation, catalyzes the covalent attachment of the ADP ribose moiety of NAD to elongation factor 2. Fragment A is responsible for enzymatic ADP-ribosylation of elongation factor 2, while fragment B is responsible for binding of toxin to cell receptors and entry of fragment A.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc) Diphtheria toxin DT NAD(+)--diphthamide ADP-ribosyltransferase recombinant recombinant-proteins proteins protein

 

TargetMol