Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00432 Copy Product Info
Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc) is expressed in E. coli.

Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc)

Catalog No. TMPH-00432
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc) is expressed in E. coli.

Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$129-In Stock
10 μg$216-In Stock
20 μg$360-In Stock
50 μg$543-In Stock
100 μg$745-In Stock
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc) is expressed in E. coli.
Species
Corynephage omega
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP00587
Synonyms
NAD(+)--diphthamide ADP-ribosyltransferase,DT,Diphtheria toxin
Amino Acid
GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRR
Construction
26-218 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Diphtheria toxin Protein, Corynephage omega, Recombinant (His & Myc)
Molecular Weight28.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Diphtheria toxin, produced by a phage infecting Corynebacterium diphtheriae, is a proenzyme that, after activation, catalyzes the covalent attachment of the ADP ribose moiety of NAD to elongation factor 2. Fragment A is responsible for enzymatic ADP-ribosylation of elongation factor 2, while fragment B is responsible for binding of toxin to cell receptors and entry of fragment A.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.