DEFB4A Protein, Human, Recombinant (Active)

Name: DEFB4A Protein, Human, Recombinant (Active)
Brand: TargetMol
SKU: TMPH-03816
Rating: 4.5 (1 reviews)

(Synonyms: Skin-antimicrobial peptide 1 (SAP1), Defensin, beta 2, Defensin beta 4A, DEFB4B, DEFB4A, DEFB4, DEFB2, DEFB102, Beta-defensin 2 (BD-2;hBD-2)) Copy Product Info

Synonyms: Skin-antimicrobial peptide 1 (SAP1), Defensin, beta 2, Defensin beta 4A, DEFB4B, DEFB4A, DEFB4, DEFB2, DEFB102, Beta-defensin 2 (BD-2;hBD-2)

Catalog No. TMPH-03816 Copy Product Info

DEFB4A Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is O15263.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$130	20 days	20 days
10 μg	$198	20 days	20 days
20 μg	$338	20 days	20 days
50 μg	$655	20 days	20 days
100 μg	$1,080	20 days	20 days
200 μg	$1,530	20 days	20 days
500 μg	$2,430	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration range of 10-100 ng/ml.
Description	DEFB4A Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is O15263.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	O15263
Amino Acid	GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Construction	24-64 aa
Protein Purity	>98% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Skin-antimicrobial peptide 1 (SAP1), Defensin, beta 2, Defensin beta 4A, DEFB4B, DEFB4A, DEFB4, DEFB2, DEFB102, Beta-defensin 2 (BD-2;hBD-2)

Chemical Properties

Molecular Weight

4.3 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

β-defensin 2 (BD-2;hBD-2)SAP1SAP 1hBD-2hBD2Defensin, β2Defensin, β 2Defensin, beta2Defensin, b2Defensin, b 2Defensin β4ADefensin β 4ADefensin b 4ADEFB 4DEFB 2DEFB 102b-defensin 2 (BD-2;hBD-2)BD-2BD2

Related Tags: DEFB4A Protein, Human, Recombinant (Active) chemical structure | DEFB4A Protein, Human, Recombinant (Active) molecular weight